PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.18G129900.1.p
Common NameGLYMA_18G129900, LOC100775434
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 207aa    MW: 23040.9 Da    PI: 10.3671
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.18G129900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.51.3e-1270114347
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          +WT+eE+ l++ + +  G+g+W+ I+r +  +Rt+ q+ s+ qky
  Glyma.18G129900.1.p  70 PWTEEEHRLFLLGLQNVGKGNWRGISRNFVMTRTPTQVASHAQKY 114
                          8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.79563119IPR017930Myb domain
SuperFamilySSF466893.07E-1665118IPR009057Homeodomain-like
TIGRFAMsTIGR015576.7E-1766117IPR006447Myb domain, plants
SMARTSM007173.7E-967117IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-1169113IPR009057Homeodomain-like
CDDcd001677.69E-970115No hitNo description
PfamPF002495.2E-1170114IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006338Biological Processchromatin remodeling
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0035066Biological Processpositive regulation of histone acetylation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003682Molecular Functionchromatin binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003713Molecular Functiontranscription coactivator activity
GO:0004402Molecular Functionhistone acetyltransferase activity
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MCSAEKDGIM LFGVRLTVSD NNPTTLRKSA SMNNLSQYDS QPPHDPNAGY ASDDVVHPSR  60
HTRERKRGVP WTEEEHRLFL LGLQNVGKGN WRGISRNFVM TRTPTQVASH AQKYFLRCHR  120
QNRRRRRSSL FDITTNSVME PWPEKEEEQA AAPSTRLKPV LPVPQSSKMA ELDLNGKSLS  180
LKLSVSKPPI SNENFGGGGD SISSVA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.231790.0leaf| pod
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0919340.0BT091934.1 Soybean clone JCVI-FLGm-9M5 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003553216.11e-154PREDICTED: transcription factor MYB1R1-like
SwissprotQ2V9B01e-44MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLK7MRR71e-154K7MRR7_SOYBN; Uncharacterized protein
STRINGGLYMA18G17143.11e-153(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53383350
Representative plantOGRP3941699
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70000.21e-57MYB_related family protein